PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc01200.1.g00030.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HD-ZIP
Protein Properties Length: 491aa    MW: 53156.7 Da    PI: 7.4901
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc01200.1.g00030.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.42.4e-18115167456
                                   -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                      Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                   +++++ eq+++Le+ Fe  +++  e++++LA+ lgL+ rqV +WFqNrRa++k
  Zpz_sc01200.1.g00030.1.am.mk 115 KRRLSVEQVRTLERSFEVANKLEPERKAQLARALGLQPRQVAIWFQNRRARWK 167
                                   44799***********************************************9 PP

2Homeobox37.63.8e-122032283156
                                   HHHHHHCTS-HHHHHHHHHHHHHHHH CS
                      Homeobox  31 eeLAkklgLterqVkvWFqNrRakek 56 
                                   ++LA+ lgL+ rqV +WFqNrRa++k
  Zpz_sc01200.1.g00030.1.am.mk 203 AQLARALGLQPRQVAIWFQNRRARWK 228
                                   79***********************9 PP

3HD-ZIP_I/II124.84.1e-40113202190
                   HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLe 81 
                                   e+krrls eqv++LE+sFe  +kLeperK++lar+Lglqprqva+WFqnrRAR+ktkqlEkdy+aL+r++da ++en++L 
  Zpz_sc01200.1.g00030.1.am.mk 113 ERKRRLSVEQVRTLERSFEVANKLEPERKAQLARALGLQPRQVAIWFQNRRARWKTKQLEKDYDALRRQLDAARAENDALL 193
                                   69******************************************************************************* PP

                   HD-ZIP_I/II  82 keveeLree 90 
                                   +++++L++e
  Zpz_sc01200.1.g00030.1.am.mk 194 AQNKKLHAE 202
                                   ******976 PP

4HD-ZIP_I/II834.2e-272032633090
                   HD-ZIP_I/II  30 velareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                                   ++lar+Lglqprqva+WFqnrRAR+ktkqlEkdy+aL+r++da ++en++L +++++L++e
  Zpz_sc01200.1.g00030.1.am.mk 203 AQLARALGLQPRQVAIWFQNRRARWKTKQLEKDYDALRRQLDAARAENDALLAQNKKLHAE 263
                                   79********************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.9E-1990170IPR009057Homeodomain-like
SuperFamilySSF466894.28E-19106171IPR009057Homeodomain-like
PROSITE profilePS5007117.2109169IPR001356Homeobox domain
SMARTSM003892.5E-18112173IPR001356Homeobox domain
CDDcd000866.25E-16114170No hitNo description
PfamPF000461.4E-15115167IPR001356Homeobox domain
PRINTSPR000319.1E-6140149IPR000047Helix-turn-helix motif
PROSITE patternPS000270144167IPR017970Homeobox, conserved site
PRINTSPR000319.1E-6149165IPR000047Helix-turn-helix motif
PfamPF021834.0E-9169204IPR003106Leucine zipper, homeobox-associated
SMARTSM003893.0E-5176234IPR001356Homeobox domain
SuperFamilySSF466898.13E-11203240IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.1E-12203237IPR009057Homeodomain-like
PfamPF000461.7E-9203228IPR001356Homeobox domain
PROSITE profilePS5007112.293204230IPR001356Homeobox domain
CDDcd000866.53E-9204231No hitNo description
PROSITE patternPS000270205228IPR017970Homeobox, conserved site
PfamPF021831.4E-8230263IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 491 aa     Download sequence    Send to blast
MATNGMAPSF FPANFLLQMQ QPLPHHHHLH QQQQAADHPH HHDHEHHLLA PPPPSLSPFL  60
HDFAGAMAPP PPMYPPDAVS DDLHAAEPQQ GGGAASDDEE GSAAVGGCGG AGERKRRLSV  120
EQVRTLERSF EVANKLEPER KAQLARALGL QPRQVAIWFQ NRRARWKTKQ LEKDYDALRR  180
QLDAARAEND ALLAQNKKLH AEAQLARALG LQPRQVAIWF QNRRARWKTK QLEKDYDALR  240
RQLDAARAEN DALLAQNKKL HAEHHLQKVY VSGSVPAICT LHLLSATRAH AMHRFLSHPP  300
SQRAACTMIS HSICLPITIS LSEAHPALCP CRHACVGWFL LQITALKGGG GGGGGGRQEA  360
ASELINLNVK ETEASCSNRS ENSSEINLDI SRPAPAADES TMNSHRPAAL PFYASAFGGR  420
SGGGSLDIDQ LLQHSHASSA PTMELGHGSG ADTGAAAAGA GFFGSLLCGG AVVDEQPAFW  480
PWAADGHHNF Q
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1112117ERKRRL
2222230RRARWKTKQ
3346356KGGGGGGGGGR
4417423GGRSGGG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7284121e-110KJ728412.1 Zea mays clone pUT6717 HB transcription factor (HB98) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002467274.13e-81hypothetical protein SORBIDRAFT_01g022420
SwissprotA2Z7348e-56HOX23_ORYSI; Homeobox-leucine zipper protein HOX23
SwissprotQ94GL58e-56HOX23_ORYSJ; Homeobox-leucine zipper protein HOX23
STRINGSb01g022420.11e-80(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15150.18e-37homeobox 3